Chemical Structure : PACAP(6-38)
CAS No.: 143748-18-9
Catalog No.: PC-23703Not For Human Use, Lab Use Only.
PACAP(6-38) is a potent, selective and competitive antagonist of PACAP type 1 receptor (PAC1R) with IC50 of 2 nM, Ki of 1.5 nM.
| Packing | Price | Stock | Quantity |
|---|---|---|---|
| 2 mg | $198 | In stock | |
| 5 mg | $358 | In stock | |
| 10 mg | $558 | In stock | |
| 25 mg | Get quote |
Bulk size, bulk discount!
E-mail: sales@probechem.com
Tech Support: tech@probechem.com
PACAP(6-38) is a potent, selective and competitive antagonist of PACAP type 1 receptor (PAC1R) with IC50 of 2 nM, Ki of 1.5 nM.
| M.Wt | 4024.78 | |
| Formula | C182H300N56O45S | |
| Appearance | Solid | |
| Storage |
|
|
| Solubility |
10 mM in DMSO |
|
| Chemical Name/SMILES |
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
|
1. Gourlet P, et al. Eur J Pharmacol. 1995 Dec 4;287(1):7-11.
2. Robberecht P, et al. Eur J Biochem. 1992 Jul 1;207(1):239-46.

Copyright © 2022 probechem.com. All Rights Reserved. probechem Copyright